GHITM Recombinant monoclonal antibody Proteintech 83548-3-RR
$299.00
In stock
SKU
83548-3-RR
240541D3, Dermal papilla-derived protein 2, DERP2, Growth hormone-inducible transmembrane protein, MICS1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag35170 Product name: Recombinant human GHITM protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-72 aa of BC010354 Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：GHITM | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：GHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein that localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
