FABP3 Monoclonal antibody proteintech 60280-1-Ig
$449.00
In stock
SKU
60280-1-Ig
FABP11, FABP3, Fatty acid binding protein 3, H FABP, M FABP, MDGI, O FABP
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag21483 Product name: Recombinant human FABP3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-133 aa of BC007021 Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007021 |
| Conjugate: Unconjugated | Gene Symbol: FABP3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2170 |
| Application: Western Blot (WB) | RRID: AB_2881398 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: FABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
