ZNF787 Polyclonal antibody proteintech 31934-1-AP
$449.00
In stock
SKU
31934-1-AP
Zinc finger protein 787, TTF-I-interacting peptide 20, Transcription Termination Factor I Interacting Peptide 20, TIP20
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag36052 Product name: Recombinant human ZNF787 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC077728 Sequence: MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPPQS Predict reactive species |
| Applications: WB, IF/ICC, ELISA | Observed Molecular Weight: 40 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC077728 |
| Conjugate: Unconjugated | Gene Symbol: ZNF787 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 126208 |
| Application: Western Blot (WB) | RRID: AB_3670151 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Zinc finger protein 787?(ZNF787, also known as TIP20) is activated in the nucleus and may be involved in transcriptional regulation. It probably is one repressor of neuronal features and can interact with histone deacetylase 1 (HDAC1) in regulating the permeability of the blood-brain barrier (BBB) as well as the pathogenesis of Alzheimer's disease (PMID: 33057419; 38329647). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
