Anti-Mouse APRIL/TNFSF13 Rabbit Recombinant Antibody Proteintech 98331-2-RR
$299.00
In stock
SKU
98331-2-RR
241666F9, A proliferation-inducing ligand, APRIL, CD256, Tnfsf13
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1561 Product name: Recombinant Mouse APRIL/TNFSF13 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 96-241 aa of NM_023517.2 Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：69583 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q9D777 | Formulation:：PBS, Azide6 |
| Background Information：TNFSF13 gene encodes tumor necrosis factor ligand superfamily member 13 (or APRIL) belonging to the tumor necrosis factor (TNF) family. APRIL is highly expressed in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages, and its precursor is cleaved by furin. APRIL may be implicated in the regulation of tumor cell growth and also monocyte/macrophage-mediated immunological processes. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
