TMEM119 Monoclonal antibody proteintech 66948-1-Ig
$449.00
In stock
SKU
66948-1-Ig
TMEM119, transmembrane protein 119, UNQ731/PRO1415
| Host / Isotype: Mouse / IgG3 | Class: Monoclonal |
| Reactivity: Human, Pig, Mouse, Rat, Rabbit And More (3) | Immunogen: CatNo: Ag26286 Product name: Recombinant human TMEM119 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 29 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_181724 |
| Conjugate: Unconjugated | Gene Symbol: TMEM119 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 338773 |
| Application: Western Blot (WB) | RRID: AB_2882272 |
| Dilution: WB : 1:20000-1:100000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Pig, Mouse, Rat, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG3 | Background Information: TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#66948-1-Ig. The predicted MW of TMEM119 is 29 kDa. Catalog#66948-1-Ig recognizes 50 kDa band may due to glycosylation. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
