Angiopoietin 2 Polyclonal antibody proteintech 24613-1-AP
$449.00
In stock
SKU
24613-1-AP
ANGPT2, AGPT 2, AGPT2, ANG 2, ANG2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag17938 Product name: Recombinant human ANGPT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 357-443 aa of BC126200 Sequence: NEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTG Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 496 aa, 57 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC126200 |
| Conjugate: Unconjugated | Gene Symbol: Angiopoietin 2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 285 |
| Application: Western Blot (WB) | RRID: AB_2879639 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Angiopoietin-2 (Ang2) is a growth factor belonging to the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway, one of the main pathways involved in angiogenesis. Angiopoietin-2 was identified through a cDNA library screening, shortly after the identification of angiopoietin-1. Angiopoietin-2, is a natural antagonist for Tie2 that disrupts in vivo angiogenesis. In adult mice and humans, Angiopoietin-2 is expressed only at sites of vascular remodeling. Angiopoietin-2 has also been found to be highly expressed in diverse tumor cells and plays an important role in tumor angiogenesis and inflammation. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
