SNAI1 Recombinant monoclonal antibody Proteintech 81584-5-RR
$299.00
In stock
SKU
81584-5-RR
Zinc finger protein SNAI1, SNAIL1, SNAI 1, SLUGH2, SLUGH 2
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag24248 Product name: Recombinant human SNAI1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 22-164 aa of BC012910 Sequence: LQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYL Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：SNAI1 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：SNAI1, a member of SNAI1 family of protein, participates in the epithelial to mesenchymal transition(EMT) and formation and maintenance of embryonic mesoderm. The snail family share a common structural, that a highly conserved C-terminal region containing a zinc finger transcription factor. SNAI1 interacts with other corepressor, such as Ajuba, PRMT5 and SIN3a or HDAC1 and 2, to repress the target gene. As the phosphorylation modification of SNAI1 protein, the range of molecular weight of SNAI1 is about 25-30 kDa (PMID: 22276203 ). Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) it is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
