Biotin Anti-Human CD81 Rabbit scFv Antibody Proteintech Biotin-SF98202

$299.00
In stock
SKU
Biotin-SF98202

 

26 kDa cell surface protein TAPA-1, CD81 antigen, CD81 molecule, S5.7, TAPA1

Formulation::PBS, Azide Formulation::PBS, Azide1
Applications:Flow Cytometry (FC) Formulation::PBS, Azide2
 Reactivity:Rabbit / scFv Formulation::PBS, Azide3
Type:CatNo: Eg1036 Product name: recombinant human CD81 protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 113-201 aa of NM_004356.4 Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK Predict reactive species Formulation::PBS, Azide4
RRID:975 Formulation::PBS, Azide5
Storage Buffer:Liquid Formulation::PBS, Azide6
Background Information:CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934). Formulation::PBS, Azide7
biogegep8 Formulation::PBS, Azide8
biogegep9 Formulation::PBS, Azide9
Formulation::PBS, Azide0 Applications:Flow Cytometry (FC)0

 

 

Reviews

Write Your Own Review
You're reviewing:Biotin Anti-Human CD81 Rabbit scFv Antibody Proteintech Biotin-SF98202
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.