KIF5A Recombinant monoclonal antibody Proteintech 84013-5-RR
$299.00
In stock
SKU
84013-5-RR
241124H5, D12S1889, Kinesin heavy chain isoform 5A, Kinesin heavy chain neuron-specific 1, MY050
| Formulation::PBS, Azide, Glycerol | Formulation::PBS, Azide, Glycerol1 |
| Applications:Western Blot (WB) | Formulation::PBS, Azide, Glycerol2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide, Glycerol3 |
| Type:CatNo: Ag15518 Product name: Recombinant human KIF5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 931-1032 aa of BC146670 Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS Predict reactive species | Formulation::PBS, Azide, Glycerol4 |
| RRID:KIF5A | Formulation::PBS, Azide, Glycerol5 |
| Storage Buffer:Liquid | Formulation::PBS, Azide, Glycerol6 |
| Background Information:Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting. | Formulation::PBS, Azide, Glycerol7 |
| biogegep8 | Formulation::PBS, Azide, Glycerol8 |
| biogegep9 | Formulation::PBS, Azide, Glycerol9 |
| Formulation::PBS, Azide, Glycerol0 | Applications:Western Blot (WB)0 |