SLC30A2 Recombinant monoclonal antibody Proteintech 83666-1-RR
$299.00
In stock
SKU
83666-1-RR
240405E3, PP12488, Proton-coupled zinc antiporter SLC30A2, ZnT 2, ZNT2
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag8232 Product name: Recombinant human SLC30A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 234-323 aa of BC006251 Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：SLC30A2 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：SLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and function as a homo- or hetero-dimer to transport Zn into vesicles (PMID: 29476070?). SLC30A2 has 2 isoforms with the molecular mass of 35 kDa (short isoform) and 41 kDa (long isoform). This antibody detects 2 bands of 35 kDa and 52 kDa ( glycosylation form of the long isoform) (PMID: 14608047, PMID: 28174721). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
