SLC38A9 Recombinant monoclonal antibody Proteintech 83182-5-RR
$299.00
In stock
SKU
83182-5-RR
URLC11, Up-regulated in lung cancer 11, Solute carrier family 38 member 9, Neutral amino acid transporter 9, 240039E7
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag15607 Product name: Recombinant human SLC38A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC066891 Sequence: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIPPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMM Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：SLC38A9 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：The mTOR complex 1 (mTORC1) protein kinase is a master growth regulator that responds to multiple environmental cues. The lysosomal amino acid transporter SLC38A9 is a physical and functional component of this sensing complex. SLC38A9 (Solute Carrier Family 38 Member 9)?was first identified as a potential amino acid transporter belonging to the slc38 family. SLC38A9 has some isoforms: 64,53,57 kDa. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
