SLC16A11 Recombinant monoclonal antibody Proteintech 83239-5-RR
$299.00
In stock
SKU
83239-5-RR
240081H5, FLJ90193, MCT 11, MCT11, Monocarboxylate transporter 11
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag24920 Product name: Recombinant human SLC16A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 397-471 aa of BC093860 Sequence: FLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：SLC16A11 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Formulation:：PBS, Azide, Glycerol7 | |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
