S100A4 Recombinant monoclonal antibody Proteintech 84221-1-RR

$299.00
In stock
SKU
84221-1-RR

 

241448A12, Calvasculin, CAPL, Fibroblast Specific Protein, Fibroblast-specific protein 1

Formulation::PBS, Azide, Glycerol Formulation::PBS, Azide, Glycerol1
Applications:Western Blot (WB) Formulation::PBS, Azide, Glycerol2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide, Glycerol3
Type:CatNo: Ag9019 Product name: Recombinant human S100A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC016300 Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK Predict reactive species Formulation::PBS, Azide, Glycerol4
RRID:S100A4 Formulation::PBS, Azide, Glycerol5
Storage Buffer:Unconjugated Formulation::PBS, Azide, Glycerol6
Background Information:S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer. Formulation::PBS, Azide, Glycerol7
biogegep8 Formulation::PBS, Azide, Glycerol8
biogegep9 Formulation::PBS, Azide, Glycerol9
Formulation::PBS, Azide, Glycerol0 Applications:Western Blot (WB)0

 

 

Reviews

Write Your Own Review
You're reviewing:S100A4 Recombinant monoclonal antibody Proteintech 84221-1-RR
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.