STT3B Monoclonal antibody Proteintech 68496-1-Ig
$299.00
In stock
SKU
68496-1-Ig
3B7A8, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B, EC:2.4.99.18, SIMP, Source of immunodominant MHC-associated peptides homolog
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Mouse / IgG1 | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag30866 Product name: Recombinant human STT3B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 173-225 aa of BC015880 Sequence: APDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKIFKKTV Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：STT3B | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：STT3B is a component of the N-oligosaccharyl transferase (OST) enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3B seems to be involved in complex substrate specificity | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
