SLC38A7 Recombinant monoclonal antibody Proteintech 83346-6-RR
$299.00
In stock
SKU
83346-6-RR
SNAT7, 240147C3, FLJ10815, FLJ12724, Sodium-coupled neutral amino acid transporter 7
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag35081 Product name: Recombinant human SLC38A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC001961 Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：SLC38A7 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：SLC38A7 also known as SNAT7, is a member of the SLC38 family that encodes sodium-coupled neutral amino acid transporters. SLC38A7 is a system N transporter that has a substrate preference for L-glutamine. It also transports other amino acids with polar side chains, as well as L-histidine and L-alanine (PMID: 21511949). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
