IGFBP6 Monoclonal antibody proteintech 67567-1-Ig
$449.00
In stock
SKU
67567-1-Ig
IGFBP 6, IGF-binding protein 6, IGF binding protein 6, IBP-6, IBP6
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag30050 Product name: Recombinant human IGFBP6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 121-240 aa of BC011708 Sequence: KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC011708 |
| Conjugate: Unconjugated | Gene Symbol: IGFBP6 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3489 |
| Application: Western Blot (WB) | RRID: AB_2882781 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Insulin-like growth factor (IGF) binding protein (IGFBP6), a 240 amino acid protein, contains an IGFBP N-terminal domain and a thyroglobulin type-1 domain. It modulates the activity of IGF and shows independent effects of IGF, such as growth inhibition and apoptosis. It can decrease the proliferation and survival of cancer cells such as lung cancer cells and naso-pharyngeal cancer cells. IGFBP-6 is distinctive for its 50-fold higher binding affinity for IGF-II over IGF-I and this specificity makes it an attractive potential therapeutic candidate for IGF-II-dependent pediatric malignancies such as rhabdomyosarcoma (RMS). In addition, it was found that IGFBP6 can promote the migration of RMS cells in an IGF-independent manner, and MAPK pathways were involved in this process. Further study reported that IGFBP6 is one of most highly expressed proteins in varicose vein tissues and is involved in the proliferation of vascular smooth muscle cells (VSMCs), which may provide insights into the underlying pathogenesis of varicose vein. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
