Anti-Human DR5/CD262 Rabbit Recombinant Antibody Proteintech 98273-1-RR
$299.00
In stock
SKU
98273-1-RR
DR5, 242319H8, CD262, Death receptor 5, KILLER
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1648 Product name: Recombinant Human DR5 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 56-182 aa of BC001281 Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：8795 | Formulation:：PBS, Azide5 |
| Storage Buffer：O14763 | Formulation:：PBS, Azide6 |
| Background Information：DR5, also known as CD262, TNFRSF10B, TRAILR2, TRICK2 and KILLER, is a widely expressed single-pass type I membrane protein belonging to the tumour necrosis factor receptor superfamily (TNFRSF). It is a receptor for TNF-related apoptosis-inducing ligand (TRAIL), which is a member of the tumor necrosis factor (TNF) family of cytokines and induces apoptosis in a wide variety of cells (PMID: 9311998). DR5 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain (DD), through which DR5 is capable to transmit the apoptotic signal (PMID: 9311998; 20531300). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
