CD4 Polyclonal antibody proteintech 19068-1-AP
$449.00
In stock
SKU
19068-1-AP
CD4 molecule, CD4mut, T-cell surface antigen T4/Leu-3, T-cell surface glycoprotein CD4
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag13616 Product name: Recombinant human CD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 419-458 aa of BC025782 Sequence: CVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI Predict reactive species |
| Applications: WB, IP, ELISA | Observed Molecular Weight: 55 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC025782 |
| Conjugate: Unconjugated | Gene Symbol: CD4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 920 |
| Application: Western Blot (WB) | RRID: ENSG00000010610 |
| Dilution: WB : 1:500-1:3000 | Conjugate: AB_10603357 |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Unconjugated |
| Host / Isotype: Rabbit / IgG | Background Information: CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells. CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation. CD4 serves as a receptor for the human immunodeficiency virus (HIV). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
