Anti-Mouse IL-21 Rabbit Recombinant Antibody Proteintech 98015-1-RR
$299.00
In stock
SKU
98015-1-RR
Il21, 230267G7, interleukin 21
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg0234 Product name: recombinant mouse IL21 protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-146 aa of NM_001291041 Sequence: PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：60505 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purfication | Formulation:：PBS, Azide6 |
| Background Information：Interleukin 21 (IL-21) is a cytokine produced predominantly by cluster of differentiation 4 (CD4+) T-cells and natural killer T-cells. IL-21 is preliminarily expressed in activated cluster of differentiation 4 (CD4+) T-cells and natural killer (NK) T-cells. IL-21 receptor (IL-21R) is a class I cytokine receptor, which requires dimerization with the indispensable common gamma chain (γc) subunit to bind IL-21. IL-21 plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. IL-21 mediates apoptosis in B-CLL cells through up-regulation of the BIM (BH3 family member) and enhances both direct and antibody-dependent cellular cytotoxicity in these cells. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
