Anti-Mouse SDC2 Rabbit Recombinant Antibody Proteintech 98399-1-RR
$299.00
In stock
SKU
98399-1-RR
CD362, Fibroglycan, Heparan sulfate proteoglycan core protein, HSPG, Hspg1
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2700 Product name: Recombinant Mouse SDC2 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 19-145 aa of NM_008304.2 Sequence: ETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEEKLGPAIKSTDVYTEKHSDNLFKRTE Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：15529 | Formulation:：PBS, Azide5 |
| Storage Buffer：P43407 | Formulation:：PBS, Azide6 |
| Background Information：SDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
