ALKBH3 Recombinant monoclonal antibody Proteintech 84314-3-RR
$299.00
In stock
SKU
84314-3-RR
241650C3, ABH3, Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, DEPC 1, DEPC1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag2982 Product name: Recombinant human ALKBH3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 148-286 aa of BC015155 Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：ALKBH3 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：ALKBH3, also named as ABH3 and DEPC-1, is a dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). It has a strong preference for single-stranded. ALKBH3 is requires molecular oxygen, alpha-ketoglutarate and iron. This gene has some isoforms with MW 19-25 kDa and 33 kDa. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
