CXCR7 Monoclonal antibody proteintech 60216-1-Ig
$449.00
In stock
SKU
60216-1-Ig
ACKR3, Atypical chemokine receptor 3, Chemokine orphan receptor 1, CMKOR1, C-X-C chemokine receptor type 7
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag14247 Product name: Recombinant human CXCR7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 273-362 aa of BC036661 Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 362 aa, 41 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC036661 |
| Conjugate: Unconjugated | Gene Symbol: CXCR7 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 57007 |
| Application: Western Blot (WB) | RRID: AB_11182925 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: CXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a member of the G-protein coupled receptor family. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as a coreceptor with CXCR4 for a restricted number of HIV isolates. Expression of CXCR7 has been associated with cardiac development as well as with tumor growth and progression. This antibody recognizes endogenous CXCR7, which has an experimentally determined molecular weight of 50 kDa (PMID: 20197403; 20388803). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
