HOPX Polyclonal antibody proteintech 11419-1-AP
$449.00
In stock
SKU
11419-1-AP
CAMEO, HOD, Homeodomain only protein, HOP, HOP homeobox, HOPX, LAGY, NECC1, OB1, Odd homeobox protein 1, SMAP31, TOTO
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag1979 Product name: Recombinant human HOPX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC014225 Sequence: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 73 aa, 8 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC014225 |
| Conjugate: Unconjugated | Gene Symbol: HOPX |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 84525 |
| Application: Western Blot (WB) | RRID: AB_10693525 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: HOPX (Homeodomain-only protein) gene has various synonyms including HOD, HOP, OB1, LAGY and NECC1. The protein encoded by this gene is an unusual homeodomain protein that lacks certain conserved residues required for DNA binding. HOPX has diverse effects on cardiac growth. Manipulation of Hopx function in murine models is associated with cardiac hypertrophy, dilation and fibrosis. HOPX protein acts as an antagonist to the serum response factor (SRF), which regulates the opposing processes of cell proliferation and differentiation. Overexpression of HOPX causes cardiac hypertrophy. HOPX protein can inhibit SRF-dependent transcriptional activation by recruiting histone deacetylase (HDAC) activity. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
