KIF5A Recombinant monoclonal antibody Proteintech 84013-4-RR

$299.00
In stock
SKU
84013-4-RR

 

241124H1, D12S1889, Kinesin heavy chain isoform 5A, Kinesin heavy chain neuron-specific 1, MY050

Formulation::PBS, Azide, Glycerol Formulation::PBS, Azide, Glycerol1
Applications:Western Blot (WB) Formulation::PBS, Azide, Glycerol2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide, Glycerol3
Type:CatNo: Ag15518 Product name: Recombinant human KIF5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 931-1032 aa of BC146670 Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS Predict reactive species Formulation::PBS, Azide, Glycerol4
RRID:KIF5A Formulation::PBS, Azide, Glycerol5
Storage Buffer:Liquid Formulation::PBS, Azide, Glycerol6
Background Information:Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting. Formulation::PBS, Azide, Glycerol7
biogegep8 Formulation::PBS, Azide, Glycerol8
biogegep9 Formulation::PBS, Azide, Glycerol9
Formulation::PBS, Azide, Glycerol0 Applications:Western Blot (WB)0

 

 

Reviews

Write Your Own Review
You're reviewing:KIF5A Recombinant monoclonal antibody Proteintech 84013-4-RR
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.