Caveolin-1 Polyclonal antibody proteintech 16447-1-AP
$449.00
In stock
SKU
16447-1-AP
Caveolin 1, CAV1, MSTP085, CGL3, CAV
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (4) | Immunogen: CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 22 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006432 |
| Conjugate: Unconjugated | Gene Symbol: CAV1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 857 |
| Application: Western Blot (WB) | RRID: AB_10732595 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in astric Cancer (PMID: 25339030). MW of Caveolin-1 is from 20-25 kDa due to phosphorylation (PMID: 10198051). |
Reviews
Write Your Own Review