Anti-Human CD40 Rabbit Recombinant Antibody Proteintech 98191-1-RR
$299.00
In stock
SKU
98191-1-RR
241760A9, B cell surface antigen CD40, B-cell surface antigen CD40, Bp50, CD40L receptor
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1797 Product name: Recombinant Human CD40/TNFRSF5 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-193 aa of NM_001250.6 Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：958 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purfication | Formulation:：PBS, Azide6 |
| Formulation:：PBS, Azide7 | |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
