Anti-Human S100A8 Rabbit Recombinant Antibody Proteintech 98411-3-RR
$299.00
In stock
SKU
98411-3-RR
CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, CFAG
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg3752 Product name: Recombinant Human S100A8 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：6279 | Formulation:：PBS, Azide5 |
| Storage Buffer：P05109 | Formulation:：PBS, Azide6 |
| Background Information：S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
