CYR61/CCN1 Polyclonal antibody proteintech 26689-1-AP
$449.00
In stock
SKU
26689-1-AP
CYR61, CCN family member 1, CCN1, Cellular communication network factor 1, Cysteine-rich angiogenic inducer 61
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, ELISA | Observed Molecular Weight: 42 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001271 |
| Conjugate: Unconjugated | Gene Symbol: CYR61 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3491 |
| Application: Western Blot (WB) | RRID: AB_2880604 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CYR61 is a member of the CYR61/CTGF/NOV (CCN) protein family. CYR61 participated in cell mitogenesis, cellular adhesion, migration, differentiation, angiogenesis, and survival. Cyr61 is especially associated with diseases related to chronic in?ammation, including RA, Crohn's disease and ulcerative colitis. CYR61 may serve essential roles as either an oncogene or a tumor suppressor, depending on the cancer cell type. CYR61 also induces angiogenesis, which supplies oxygen and nutrients to tumors during growth. CYR61 can also play a role in the proliferation, invasion, survival, and metastasis of cancer cells. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
