CHCHD2 Polyclonal antibody proteintech 19424-1-AP
$449.00
In stock
SKU
19424-1-AP
C7orf17, CHCHD2, MNRR1, NS2TP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag13752 Product name: Recombinant human CHCHD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC003079 Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 151 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC003079 |
| Conjugate: Unconjugated | Gene Symbol: CHCHD2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 51142 |
| Application: Western Blot (WB) | RRID: AB_10638907 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
