CPT2 Polyclonal antibody proteintech 26555-1-AP
$449.00
In stock
SKU
26555-1-AP
Carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, CPT II, CPTASE, EC:2.3.1.21
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (4) | Immunogen: CatNo: Ag24897 Product name: Recombinant human CPT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-178 aa of BC002445 Sequence: GQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYILGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHL Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 74 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002445 |
| Conjugate: Unconjugated | Gene Symbol: CPT2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1376 |
| Application: Western Blot (WB) | RRID: AB_2880551 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Carnitine palmitoyltransferase-1 and -2 (CPT1 and CPT2) are two genetically distinct mitochondrial membrane bound enzymes and play critical role in the regulation of FAO in normal cells. CPT2 is an ubiquitous protein and locates in the inner membrane of mitochondrial (PMID: 29437870). CPT2 is frequently down-regulated in primary ovarian serous carcinomas, which is significantly correlated with poor survival of ovarian cancer patients (PMID: 33486313). Down-regulation of CPT2 was a major cause of acylcarnitine accumulation and a common feature in mouse models of obesity- and NASH-driven HCC and human SH-HCC (PMID: 29872321). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
