S1PR2 Polyclonal antibody proteintech 21180-1-AP
$449.00
In stock
SKU
21180-1-AP
AGR16, EDG 5, EDG5, Endothelial differentiation G-protein coupled receptor 5, Gpcr13
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag15470 Product name: Recombinant human S1PR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-353 aa of BC069598 Sequence: LNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV Predict reactive species |
| Applications: WB, IHC, IF-P, IF-Fro, IP, ELISA | Observed Molecular Weight: 353 aa, 39 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC069598 |
| Conjugate: Unconjugated | Gene Symbol: S1PR2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9294 |
| Application: Western Blot (WB) | RRID: AB_10694573 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: S1PR2 (sphingosine-1-phosphate receptor 2), also known as S1P2 or EDG5, is one of five G-protein-coupled receptors for sphingosine-1-phosphate (S1P), a biologically active metabolic product of sphingolipid (PMID: 18787560). S1P and its receptors have important regulatory functions in normal physiology and disease processes, particularly involving the immune, central nervous, and cardiovascular systems (PMID: 21339489). S1PR2 plays a role in acute vascular inflammation (PMID: 23723450). S1PR2 signaling is implicated in STAT3 activation (PMID: 22606352). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
