GSK3B Recombinant monoclonal antibody proteintech 82061-1-RR
$449.00
In stock
SKU
82061-1-RR
GSK3 beta, 4N21, EC:2.7.11.1, EC:2.7.11.26, GSK 3 beta
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species |
| Applications: WB, IHC, IP, ELISA | Observed Molecular Weight: 433 aa, 48 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000251 |
| Conjugate: Unconjugated | Gene Symbol: GSK3B |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2932 |
| Application: Western Blot (WB) | RRID: AB_3086460 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase.GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation. In skeletal muscle, it contributes to INS regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
