EAAT2 Monoclonal antibody proteintech 67083-1-Ig
$449.00
In stock
SKU
67083-1-Ig
GLT1, SLC1A2, 1C8D10, GLT 1, Sodium-dependent glutamate/aspartate transporter 2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag19816 Product name: Recombinant human SLC1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
| Applications: WB, IF, ELISA | Observed Molecular Weight: 574 aa, 62 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC132768 |
| Conjugate: Unconjugated | Gene Symbol: EAAT2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6506 |
| Application: Western Blot (WB) | RRID: AB_2882391 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE.(PMID: 22114258) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
