ARF1 Monoclonal antibody proteintech 68069-1-Ig
$449.00
In stock
SKU
68069-1-Ig
1C10E3, ADP ribosylation factor 1, ADP-ribosylation factor 1, EC:3.6.5.2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit | Immunogen: CatNo: Ag28021 Product name: Recombinant human ARF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-181 aa of BC009247 Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK Predict reactive species |
| Applications: WB, IF/ICC, IP, ELISA | Observed Molecular Weight: 21 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC009247 |
| Conjugate: Unconjugated | Gene Symbol: ARF1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 375 |
| Application: Western Blot (WB) | RRID: AB_2918810 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. It mainly functions in coat recruitment.(PMID: 7759471, PMID: 16042562). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
