IGFBP3 Polyclonal antibody proteintech 10189-2-AP
$449.00
In stock
SKU
10189-2-AP
BP 53, IBP 3, IBP3, IBP-3, IGF binding protein 3
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (2) | Immunogen: CatNo: Ag0242 Product name: Recombinant human IGFBP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 134-291 aa of BC000013 Sequence: PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 32 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000013 |
| Conjugate: Unconjugated | Gene Symbol: IGFBP3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3486 |
| Application: Western Blot (WB) | RRID: AB_2123233 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Insulin-like growth factor binding protein-3 (IGFBP-3) contains a 27 amino acid putative signal sequence followed by a mature protein of 264 amino acids with 18 cysteine residues clustered near the N- and C-terminus. Accordingly, expression of the cloned IGFBP-3 cDNA in mammalian tissue culture cells results in secretion of the protein into the culture medium. IGFBP-3 shares high homology (33% amino acid identity) including conservation of all 18 cysteine residues with a smaller human IGF-binding protein (BP-28) identified in amniotic fluid. IGFBP-3 has one or more glycosylation sites with a protein core of ?30 kDa. Western blots revealed that the 39-45 kDa IGFBP-3 fragment is a glycoprotein. (PMID: 23403918, PMID: 24926947, PMID: 19887447) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
