MTAP Polyclonal antibody proteintech 11475-1-AP
$449.00
In stock
SKU
11475-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag2051 Product name: Recombinant human MTAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC018625 Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 283 aa, 31 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC018625 |
| Conjugate: Unconjugated | Gene Symbol: MTAP |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4507 |
| Application: Western Blot (WB) | RRID: AB_2147094 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: MTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
