Aquaporin 4 Monoclonal antibody proteintech 68448-1-Ig
$449.00
In stock
SKU
68448-1-Ig
AQP4, Aquaporin-4, Aquaporin4, AQP-4, AQP 4
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit | Immunogen: CatNo: Ag9830 Product name: Recombinant human AQP4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 323 aa, 35 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC022286 |
| Conjugate: Unconjugated | Gene Symbol: Aquaporin 4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 361 |
| Application: Western Blot (WB) | RRID: AB_3085160 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
