CEP164 Polyclonal antibody proteintech 22227-1-AP
$449.00
In stock
SKU
22227-1-AP
3F2B7, CEP 164, KIAA1052, centrosomal protein 164kDa, NPHP15
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Canine And More (1) | Immunogen: CatNo: Ag17570 Product name: Recombinant human CEP164 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC000602 Sequence: MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 1460 aa, 164 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000602 |
| Conjugate: Unconjugated | Gene Symbol: CEP164 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 22897 |
| Application: Western Blot (WB) | RRID: AB_2651175 |
| Dilution: WB : 1:200-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Canine | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CEP164, also called KIAA1052 or NPHP15, is a 1460 amino acid protein containing 1 WW domain. CEP164 localizes in the microtubule organizing center and is expressed in several cell lines. CEP164 plays a role in microtubule organization and/or maintenance for the formation of primary cilia, a microtubule-based structure that protrudes from the surface of epithelial cells. CEP164 plays a critical role in the G2/M checkpoint and nuclear divisions. The expression of CEP164 is normally limited to the mother centriole, and CEP164 can be used as a useful marker for mother centriole. |
Reviews
Write Your Own Review