Alpha Synuclein Monoclonal antibody proteintech 66412-1-Ig
$449.00
In stock
SKU
66412-1-Ig
1, a-synuclein, SNCA, 1B10E9, Alpha-synuclein
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag1285 Product name: Recombinant human a-Synuclein protein Source: e coli.-derived, PKG Tag: GST Domain: 1-140 aa of BC013293 Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 14 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC013293 |
| Conjugate: Unconjugated | Gene Symbol: Alpha Synuclein |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6622 |
| Application: Western Blot (WB) | RRID: AB_2881784 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
