Calbindin-D28k Monoclonal antibody proteintech 66394-1-Ig
$449.00
In stock
SKU
66394-1-Ig
CALB1, Calbindin, 1F8B9, CALB, calbindin 1, 28kDa
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit | Immunogen: CatNo: Ag5861 Product name: Recombinant human Calbindin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 109-261 aa of BC006478 Sequence: KYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN Predict reactive species |
| Applications: WB, IHC, IF-P, IF-Fro, ELISA | Observed Molecular Weight: 30 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006478 |
| Conjugate: Unconjugated | Gene Symbol: Calbindin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 793 |
| Application: Western Blot (WB) | RRID: AB_2881769 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
