FGFR3 Monoclonal antibody proteintech 66954-1-Ig
$449.00
In stock
SKU
66954-1-Ig
JTK4, HSFGFR3EX, FGFR 3, CEK2, CD333
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag26290 Product name: Recombinant human FGFR3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-125 aa of NM_000142 Sequence: MESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRV Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 87 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_000142 |
| Conjugate: Unconjugated | Gene Symbol: FGFR3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2261 |
| Application: Western Blot (WB) | RRID: AB_2882277 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Fibroblast growth factors (FGFs) are polypeptide growth factors involved in a variety of activities including mitogenesis, angiogenesis, and wound healing (PMID: 1847508). The human FGF receptor family, a subfamily of receptor tyrosine kinases (RTKs), comprises of four family members-FGFR1, FGFR2, FGFR3, and FGFR4 (PMID: 23900974). Each receptor contains an extracellular domain with either two or three immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tyrosine kinase domain. FGFR3 binds acidic and basic fibroblast GH and plays a role in bone development and maintenance. Mutations in the FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia. Due to frequent mutations in certain cancers, the FGFR3 gene has also been associated with tumor progression. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
