FOLR1 Monoclonal antibody proteintech 60307-1-Ig
$449.00
In stock
SKU
60307-1-Ig
2B4B7, Adult folate binding protein, Adult folate-binding protein, FBP, Folate receptor 1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag19959 Product name: Recombinant human FOLR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 55-93 aa of BC002947 Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 257 aa, 30 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002947 |
| Conjugate: Unconjugated | Gene Symbol: FOLR1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2348 |
| Application: Western Blot (WB) | RRID: AB_2881421 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
