c-Met (Cytoplasmic) Polyclonal antibody proteintech 25869-1-AP
$449.00
In stock
SKU
25869-1-AP
c-Met, MET, AUTS9, c Met, EC:2.7.10.1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat, canine | Immunogen: CatNo: Ag23140 Product name: Recombinant human MET protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 965-1085 aa of BC130420 Sequence: GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG Predict reactive species |
| Applications: WB, IHC, FC (Intra), IP, CoIP, RIP, ELISA | Observed Molecular Weight: 1390 aa, 155 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC130420 |
| Conjugate: Unconjugated | Gene Symbol: MET |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4233 |
| Application: Western Blot (WB) | RRID: AB_2880276 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Canine | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: c-Met (also named MET or HGFR) is a receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to the HGF ligand. c-Met regulates many physiological processes including proliferation, scattering, morphogenesis, and survival. The primary single-chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide-linked to form the mature receptor. Overexpression and/or mutation of c-Met has been reported in various human malignancies, including lung cancer, breast cancer, head and neck cancer, gastric cancer, colorectal cancer, bladder cancer, uterine cervix carcinoma, esophageal carcinoma, c-Met could serve as an important therapeutic target (PMID: 26036285). The c-met receptor is a 190-kD glycoprotein consisting of a 145-kD membrane-spanning beta chain and a 50-kD alpha chain (PMID: 7806559). In Western blot, this antibody produces bands of unknown identity at 55 and 100 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
