eNOS Polyclonal antibody proteintech 27120-1-AP
$449.00
In stock
SKU
27120-1-AP
NOS3, cNOS, EC:1.14.13.39, ECNOS, EC-NOS
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (2) | Immunogen: CatNo: Ag25712 Product name: Recombinant human NOS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of Sequence: MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 133 kDa, 69 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: 4846 |
| Conjugate: Unconjugated | Gene Symbol: AB_2880764 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): Unconjugated |
| Application: Western Blot (WB) | RRID: Liquid |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Antigen affinity purification |
| Tested Reactivity: Human, Mouse | Form: P29474 |
| Host / Isotype: Rabbit / IgG | Background Information: Endothelial NOS(eNOS), also known as nitric oxide synthase 3(NOS3), has a protective function in the cardiovascular system, which is attributed to NO production. NOS3 has 3 isoforms of 68, 69, 133 kDa. Polymorphisms in NOS3 gene affects the susceptibility to several diseases such as hypertension, preeclampsia, diabetes mellitus, obesity, erectile dysfunction, and migraine. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
