CD61 / Integrin beta 3 Monoclonal antibody proteintech 66952-1-Ig
$449.00
In stock
SKU
66952-1-Ig
CD61, GP3A, GPIIIa, Integrin beta 3, ITGB3
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag27834 Product name: Recombinant human ITGB3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 634-718 aa of BC127666 Sequence: CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD Predict reactive species |
| Applications: WB, IP, IHC, ELISA | Observed Molecular Weight: 788 aa, 87 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC127666 |
| Conjugate: Unconjugated | Gene Symbol: Integrin beta 3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3690 |
| Application: Western Blot (WB) | RRID: AB_2882275 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Integrin beta-3, also named as CD61 and GPIIIa, is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin beta-3 recognize the sequence R-G-D in a wide array of ligands and the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen which leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Human integrin beta-3 has a calculated molecular weight of 87 kDa. As a result of glycosylation, the apparent molecular mass of integrin beta-3 is approximately 90-110 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
