ALR Polyclonal antibody proteintech 11293-1-AP
$449.00
In stock
SKU
11293-1-AP
GFER, EC:1.8.3.2, ERV1, FAD-linked sulfhydryl oxidase ALR, Hepatopoietin
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag1840 Product name: Recombinant human GFER protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC028348 Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD Predict reactive species |
| Applications: WB, IHC, IF-P, FC (Intra), IP, ELISA | Observed Molecular Weight: 15 kDa, 23 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC028348 |
| Conjugate: Unconjugated | Gene Symbol: GFER |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2671 |
| Application: Western Blot (WB) | RRID: AB_2109970 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: GFER (FAD-linked sulfhydryl oxidase) is also named as ALR, HERV1, HPO. It plays an important role in the disulfide relay system (DRS) in human mitochondria. The GFER gene codes for 2 distinct isoforms that are probably synthesized from the same mRNA with the use of different initiation codons. The long isoform (205 amino acids, 23/21 kD) is located mainly in the mitochondrial intermembrane space and exists under nonreducing and nondenaturing conditions as a homodimer and a heterodimer. The shorter isoform (125 amino acids, 15 kD), which lacks 80 amino acids at its N terminus compared to the longer isoform, is present predominantly in the nucleus (PMID: 19409522, 24880092, 21152698). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
