PFN2 Monoclonal antibody proteintech 60094-2-Ig
$449.00
In stock
SKU
60094-2-Ig
Prifilin 2, Profilin II, profilin 2, PFL, D3S1319E
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag5043 Product name: Recombinant human PFN2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-140 aa of BC018049 Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 140 aa, 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC018049 |
| Conjugate: Unconjugated | Gene Symbol: PFN2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5217 |
| Application: Western Blot (WB) | RRID: AB_2163215 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: PFN2 (profilin 2) is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. The MW of this protein is 15 kDa, and this antibody specially recognises the 15 kDa protein. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
