SLC40A1/FPN1 Polyclonal antibody proteintech 26601-1-AP
$449.00
In stock
SKU
26601-1-AP
Ferroportin 1, FPN1, SLC40A1, Ferroportin-1, FPN
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (5) | Immunogen: CatNo: Ag24273 Product name: Recombinant human SLC40A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 398-500 aa of BC037733 Sequence: LDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPETSPESVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMN Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 62 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC037733 |
| Conjugate: Unconjugated | Gene Symbol: SLC40A1/Ferroportin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 30061 |
| Application: Western Blot (WB) | RRID: AB_2880571 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SLC40A1, also named as Ferroportin 1 (FPN1), is an iron transporter which is involved in iron export from duodenal epithelial cell and also in transfer of iron between maternal and fetal circulation. It has been reported that SLC40A1 mutations may lead to macrophage iron overload, hyperferritinemia, and normal transferrin saturation among ferroportin iron overload patients. This antibody detects 50-75 kDa protein as well as the fragments of 56 kDa and 35 kDa protein similar to papers in SDS-PAGE (PMID:32645092,?21396368,16054062, 18974313). SLC40A1 is mainly localized to the cell membrane, but may also be detected in the cytoplasm. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
