SLC25A46 Recombinant monoclonal antibody Proteintech 83360-2-RR
$299.00
In stock
SKU
83360-2-RR
240114G3, Mitochondrial outer membrane protein SLC25A46, TB1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag27293 Product name: Recombinant human SLC25A46 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 222-382 aa of BC017169 Sequence: IETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISSVIQKFVLLILKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPINTQYEGMRDCINTIRQEEGV Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：SLC25A46 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：Solute carrier family 25 member 46 (SLC25A46), a highly conserved protein among various species including vertebrates, is a nuclear gene encoding mitochondrial carriers. SLC25A46 is involved in mitochondrial fission and the transport of lipids from the endoplasmic reticulum to mitochondria (PMID: 33277645). SLC25A46 has 3 isoforms with molecular weights of 30, 37 and 46 kDa, respectively. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
