FAM38B Recombinant monoclonal antibody Proteintech 83488-4-RR
$299.00
In stock
SKU
83488-4-RR
Piezo2, 240406E5, C18orf30, Transmembrane protein C18orf30
| Formulation::PBS, Azide, Glycerol | Formulation::PBS, Azide, Glycerol1 |
| Applications:Western Blot (WB) | Formulation::PBS, Azide, Glycerol2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide, Glycerol3 |
| Type:CatNo: Ag24528 Product name: Recombinant human FAM38B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 306-401 aa of AB527139 Sequence: KQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN Predict reactive species | Formulation::PBS, Azide, Glycerol4 |
| RRID:FAM38B | Formulation::PBS, Azide, Glycerol5 |
| Storage Buffer:Liquid | Formulation::PBS, Azide, Glycerol6 |
| Background Information:FAM38B, also named as PIEZO2, is a mechanosensitive, rapidly inactivating (RI) ion channel which is open and converts the mechanical stimulus signals into bioelectrical signals after stimulated by mechanical signals. FAM38B has been recently identified in dorsal root ganglion (DRG) neurons to mediate tactile transduction. It plays an important role in the biological process, maintaining cell metabolism and cell migration. Loss-of-function mutations in the human?FAM38B?gene cause an autosomal recessive syndrome of muscular atrophy with perinatal respiratory distress, arthrogryposis, and scoliosis.The 80 kDa band detected by SDS-PAGE can be caused by alternative splicing (PMID: 34335288, 37227654). | Formulation::PBS, Azide, Glycerol7 |
| biogegep8 | Formulation::PBS, Azide, Glycerol8 |
| biogegep9 | Formulation::PBS, Azide, Glycerol9 |
| Formulation::PBS, Azide, Glycerol0 | Applications:Western Blot (WB)0 |